PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06021A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 290aa    MW: 31768.8 Da    PI: 4.6105
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06021AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.7e-0733612048
                               TTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding 20 GggtWktIartmgkgRtlkqcksrwqkyl 48
                               G  +W+++++  g+ R++k+c++rw +yl
  Oropetium_20150105_06021A 33 GQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                               6669*********99************97 PP

2Myb_DNA-binding55.11.7e-1770111447
                                S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                 ++eE++  +++++qlG++ W++Ia++++ gRt++++k++w+++
  Oropetium_20150105_06021A  70 LSEEEEKTVIELHAQLGNR-WSKIASRLP-GRTDNEIKNHWNTH 111
                                69*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-11562IPR009057Homeodomain-like
SuperFamilySSF466892.51E-8868IPR009057Homeodomain-like
PROSITE profilePS500908.107961IPR017877Myb-like domain
SMARTSM007170.541363IPR001005SANT/Myb domain
PfamPF002495.8E-63261IPR001005SANT/Myb domain
SuperFamilySSF466894.16E-2148121IPR009057Homeodomain-like
PROSITE profilePS5129427.29162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2463116IPR009057Homeodomain-like
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002497.8E-1670111IPR001005SANT/Myb domain
CDDcd001671.18E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAX XXXXXXXXXL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLRRGLL SEEEEKTVIE LHAQLGNRWS KIASRLPGRT DNEIKNHWNT HIKKKLRNMG  120
IDPATHKPLQ PEAASSSPPQ QPLKQQQQPE DEEKAAASGG SGAGLGTETF STDEVPMVDD  180
IVLPCDDDVI VSSGINTAGS SESSLPSSSS SSSYSAAAPA SSGDSSSSTA AVDGEWPEWA  240
QIMEWPDSMW LDDVVNAPWE FEDPFVTYQR IALFDHPDAW NDSNELELS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0837351e-136BT083735.2 Zea mays full-length cDNA clone ZM_BFb0033K01 mRNA, complete cds.
GenBankBT0855211e-136BT085521.2 Zea mays full-length cDNA clone ZM_BFc0028P12 mRNA, complete cds.
GenBankBT0856251e-136BT085625.2 Zea mays full-length cDNA clone ZM_BFc0040A03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956767.11e-113PREDICTED: protein ODORANT1-like
SwissprotQ50EX69e-78ODO1_PETHY; Protein ODORANT1
TrEMBLK3ZZA71e-112K3ZZA7_SETIT; Uncharacterized protein
STRINGSi031939m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.18e-76myb domain protein 20